Recombinant Human Growth/differentiation factor 15 (GDF15), partial

• Product Name Alternative:

  Macrophage inhibitory cytokine 1 ; MIC-1NSAID-activated gene 1 protein ; NAG-1NSAID-regulated gene 1 protein ; NRG-1; Placental TGF-betaPlacental bone morphogenetic protein; Prostate differentiation factor

• Abbreviation:

  Recombinant Human GDF15 protein, partial

• Gene Name:

  GDF15

• UniProt:

  Q99988

• Expression Region:

  198-308aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

• Tag:

  N-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Cardiovascular

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  16.2 kDa

• References & Citations:

  PLAB, a novel placental bone morphogenetic protein.Hromas R., Hufford M., Sutton J., Xu D., Li Y., Lu L.Biochim. Biophys. Acta 1354:40-44 (1997)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial