Recombinant Mouse Growth-regulated alpha protein (Cxcl1), partial

• Product Name Alternative:

  C-X-C motif chemokine 1; Platelet-derived growth factor-inducible protein KCSecretory protein N51

• Abbreviation:

  Recombinant Mouse Cxcl1 protein, partial

• Gene Name:

  Cxcl1

• UniProt:

  P12850

• Expression Region:

  29-96aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Has chotactic activity for neutrophils. Contributes to neutrophil activation during inflammation . Hatoregulatory chokine, which, in vitro, suppresses hatopoietic progenitor cell proliferation. KC (5-72) shows a highly enhanced hatopoietic activity.1 Publication

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation (By similarity) . Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC (5-72) shows a highly enhanced hematopoietic activity.

• Molecular Weight:

  11.5 kDa

• References & Citations:

  The platelet-derived growth factor-inducible KC gene encodes a secretory protein related to platelet alpha-granule proteins.Oquendo P., Alberta J., Wen D., Graycar J.L., Derynck R., Stiles C.D.J. Biol. Chem. 264:4133-4137 (1989)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial