Recombinant Human Angiopoietin-like protein 8 (ANGPTL8)

• Product Name Alternative:

  Betatrophin1

• Abbreviation:

  Recombinant Human C19orf80 protein

• Gene Name:

  C19orf80

• UniProt:

  Q6UXH0

• Expression Region:

  22-198aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

• Tag:

  N-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Cell Biology

• Relevance:

  Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels . May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels

• Molecular Weight:

  23.9 kDa

• References & Citations:

  Identification of genes differentially expressed in human hepatocellular carcinoma by a modified suppression subtractive hybridization method.Dong X.Y., Pang X.W., Yu S.T., Su Y.R., Wang H.C., Yin Y.H., Wang Y.D., Chen W.F.Int. J. Cancer 112:239-248 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein