Recombinant Bovine Selenoprotein P (SELENOP) (U59S, U297S, U307S, U338S, U350S, U363S, U365S, U372S, U388S, U390S, U397S, U399S)

• Product Name Alternative:

  Selenoprotein P-like protein

• Abbreviation:

  Recombinant Bovine SELENOP protein (Mutant type)

• Gene Name:

  SELENOP

• UniProt:

  P49907

• Expression Region:

  20-402aa (U59S, U297S, U307S, U338S, U350S, U363S, U365S, U372S, U388S, U390S, U397S, U399S)

• Organism:

  Bos taurus (Bovine)

• Target Sequence:

  ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLSRKRCINQLLSQFPKDSESALSSCCCHCRHLVFEKTGSAITSQCTEKLPSLCSSQGLLAEENVIESSQSRLPPAASQAAGQQLNPTEASTKSSSKNKAKMSKSPSN

• Tag:

  N-terminal GST-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells.

• Molecular Weight:

  70.1 kDa

• References & Citations:

  Molecular cloning of cDNA encoding a bovine selenoprotein P-like protein containing 12 selenocysteines and a (His-Pro) rich domain insertion, and its regional expression.Saijoh K., Saito N., Lee M.J., Fujii M., Kobayashi T., Sumino K.Brain Res. Mol. Brain Res. 30:301-311 (1995)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein