Recombinant Mouse CD82 antigen (Cd82), partial

• Product Name Alternative:

  C33 antigenIA4Inducible membrane protein R2Metastasis suppressor Kangai-1 homolog; CD82

• Abbreviation:

  Recombinant Mouse Cd82 protein, partial

• Gene Name:

  Cd82

• UniProt:

  P40237

• Expression Region:

  111-227aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF

• Tag:

  N-terminal 6xHis-SUMO-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

• Molecular Weight:

  29.5 kDa

• References & Citations:

  The mouse C2C12 myoblast cell surface N-linked glycoproteome identification, glycosite occupancy, and membrane orientation.Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.Mol. Cell. Proteomics 8:2555-2569 (2009)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Extracellular Domain