Recombinant Human AP-1 complex subunit sigma-3 (AP1S3)

• Product Name Alternative:

  Adaptor protein complex AP-1 subunit sigma-1C; Adaptor-related protein complex 1 subunit sigma-1C; Clathrin assembly protein complex 1 sigma-1C small chain; Golgi adaptor HA1/AP1 adaptin sigma-1C subunit; Sigma 1C subunit of AP-1 clathrin; Sigma-adaptin 1C; Sigma1C-adaptin

• Abbreviation:

  Recombinant Human AP1S3 protein

• Gene Name:

  AP1S3

• UniProt:

  Q96PC3

• Expression Region:

  1-104aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA

• Tag:

  N-terminal GST-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to mbranes and the recognition of sorting signals within the cytosolic tails of transmbrane cargo molecules. Involved in TLR3 trafficking .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking

• Molecular Weight:

  39.7 kDa

• References & Citations:

  AP1S3 mutations are associated with pustular psoriasis and impaired Toll-like receptor 3 trafficking.Setta-Kaffetzi N., Simpson M.A., Navarini A.A., Patel V.M., Lu H.C., Allen M.H., Duckworth M., Bachelez H., Burden A.D., Choon S.E., Griffiths C.E., Kirby B., Kolios A., Seyger M.M., Prins C., Smahi A., Trembath R.C., Fraternali F. , Smith C.H., Barker J.N., Capon F.Am. J. Hum. Genet. 94:790-797 (2014)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Isoform 3