Recombinant Mesocricetus auratus Multifunctional fusion protein (Il1b)

• Product Name Alternative:

  (IL1B)

• Abbreviation:

  Recombinant Mesocricetus auratus Il1b protein

• Gene Name:

  Il1b

• UniProt:

  A0A1U7Q9G0

• Expression Region:

  1-267aa

• Organism:

  Mesocricetus auratus (Golden hamster)

• Target Sequence:

  MATVPELDSEMIAFHSDENDLFFEVDGLQKMKSCFQSLDLSYPDESIQLQISKQDLNKSFRQVVSVIVAVEKLWNTPVPCPWTFQDEDLRTFFSFIFEEEPIFCDSWDGELIVADAPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNINQQVVFSMSFVQGETSNNKIPVALGLKGKNLYLSCVMKGDTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHKPVFLGNNSGQDLVDFTMESVSS

• Tag:

  N-terminal 6xHis-tagged and C-terminal Strep II-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Potent pro-inflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  32.6 kDa

• References & Citations:

  1 RefSeq Submitted (APR-2022) to UniProtKB Cited for: IDENTIFICATION.

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length