Recombinant Klebsiella pneumoniae Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial

• Product Name Alternative:

  4-amino-4-deoxy-L-arabinose lipid A transferase Lipid IV (A) 4-amino-4-deoxy-L-arabinosyltransferase Undecaprenyl phosphate-alpha-L-Ara4N transferase

• Abbreviation:

  Recombinant Klebsiella pneumoniae arnT protein, partial

• Gene Name:

  ArnT

• UniProt:

  B5XTL1

• Expression Region:

  429-551aa

• Organism:

  Klebsiella pneumoniae (strain 342)

• Target Sequence:

  RVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAGFADWLATHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ

• Tag:

  N-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Epigenetics and Nuclear Signaling

• Relevance:

  Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides. Catalytic activity 4-amino-4-deoxy-alpha-L-arabinopyranosyl di-trans, octa-cis-undecaprenyl phosphate + lipid IV (A) = lipid II (A) + di-trans, octa-cis-undecaprenyl phosphate. Pathway: 4-amino-4-deoxy-beta-L-arabinose-lipid A biosynthesis This protein is involved in the pathway 4-amino-4-deoxy-beta-L-arabinose-lipid A biosynthesis, which is part of Lipopolysaccharide metabolism.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  17.8 kDa

• References & Citations:

  "Complete genome sequence of the N2-fixing broad host range endophyte Klebsiella pneumoniae 342 and virulence predictions verified in mice." Fouts D.E., Tyler H.L., DeBoy R.T., Daugherty S., Ren Q., Badger J.H., Durkin A.S., Huot H., Shrivastava S., Kothari S., Dodson R.J., Mohamoud Y., Khouri H., Roesch L.F.W., Krogfelt K.A., Struve C., Triplett E.W., Methe B.A. PLoS Genet. 4:E1000141-E1000141 (2008)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial