Recombinant Enterobacteria phage K3 Holin (T), partial

CAT:
399-GTR04825854
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Enterobacteria phage K3 Holin (T), partial

  • Product Name Alternative:

    (Lysis protein)

  • Abbreviation:

    Recombinant Enterobacteria phage K3 Holin protein, partial

  • Gene Name:

    T

  • UniProt:

    P10393

  • Expression Region:

    50-218aa

  • Organism:

    Enterobacteria phage K3 (Bacteriophage K3)

  • Target Sequence:

    RGDSFFEYYKQSKYETYSEIIEKERNARFESVALEQLQIVHISSEADFSAVYSFRPKNLNYFVDIIAYEGKLPSTISEKSLGGYPVDKTMDEYTVHLNGRHYYSNSKFAFLPTKKPTPEINYMYSCPYFNLDNIYAGTITMYWYRNDHISNDRLESICSQAARILGRAK

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Exhibits a coumarin 7-hydroxylase activity. Active in the metabolic activation of hexamethylphosphoramide, N, N-dimethylaniline, 2'-methoxyacetophenone, N-nitrosomethylphenylamine, and the tobacco-specific carcinogen, 4- (methylnitrosamino) -1- (3-pyridyl) -1-butanone. Possesses phenacetin O-deethylation activity.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    27.2 kDa

  • References & Citations:

    "Single nucleotide polymorphisms of the human cyp2a13 gene: evidence for a null allele." Zhang X., Chen Y., Liu Y., Ren X., Zhang Q.Y., Caggana M., Ding X. Drug Metab Dispos 31:1081-1085 (2003)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial