Recombinant Gossypium hirsutum Transcription factor bHLH84-like (LOC107908183)

CAT:
399-GTR04832150
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Gossypium hirsutum Transcription factor bHLH84-like (LOC107908183)

  • Abbreviation:

    Recombinant Gossypium hirsutum LOC107908183 protein

  • Gene Name:

    LOC107908183

  • UniProt:

    A0A1U8JKW4

  • Expression Region:

    1-272aa

  • Organism:

    Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

  • Target Sequence:

    MDSMGTLLEGDWSCFSGMYTTEQEADFMAQLLSNCPQLPDIDMSNYLSDSNPVFVTNNSPISMDFCMEDGTNTSFFLVEPDDCLNPEMGKDGNVEKEPKPEPEKKSSNKRSRNSGDVHVQKTKRNGRSKKNQTIAANDDEDGNGGLNGQSWASCSSEDDSNGGANSGSKGEATLNLNGKTRASRGAATDPQSLYARKRRERINERLRILQNLVPNGTKVDISTMLEEAVQYVKFLQLQIKLLSSDDLWMYAPIAYNGMDIGIDLKVGTAKRT

  • Tag:

    N-terminal 6xHis-KSI-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    45.3 kDa

  • References & Citations:

    "Genome sequence of cultivated Upland cotton (Gossypium hirsutum TM-1) provides insights into genome evolution." Li F., Fan G., Lu C., Xiao G., Zou C., Kohel R.J., Ma Z., Shang H., Ma X., Wu J., Liang X., Huang G., Percy R.G., Liu K., Yang W., Chen W., Du X., Shi C. Yu S. Nat. Biotechnol. 33:524-530 (2015)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length