Recombinant Macaca mulatta Interleukin-6 protein (IL6) (Active)

CAT:
399-GTR04836096
Size:
500 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Macaca mulatta Interleukin-6 protein (IL6) (Active)

  • Product Name Alternative:

    IL-6

  • Abbreviation:

    Recombinant Rhesus macaque IL6 protein (Active)

  • Gene Name:

    IL6

  • UniProt:

    P51494

  • Expression Region:

    28-212aa

  • Organism:

    Macaca mulatta (Rhesus macaque)

  • Target Sequence:

    M+APVLPGEDSKNVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSNLRALRQM

  • Tag:

    Tag-Free

  • Type:

    Active Protein & In Stock Protein

  • Source:

    E.Coli

  • Field of Research:

    Immunology

  • Relevance:

    Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity) . {ECO:0000250}.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    >97% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay usingIL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 x 107 IU/mg.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 µm filtered concentrated solution in 50 mM Tris-HCl, pH9.0, 600 mM NaCl, with 0.02 % Tween-20.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity) .

  • Molecular Weight:

    21.1 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein