Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial

• Product Name Alternative:

  D16Ertd61e; Epitheliasin; FLJ41954; MGC6821; PP9284; PRSS10; Serine protease 10; TMPRSS2; TMPRSS2 ERG FUSION GENE, INCLUDED; TMPRSS2 ETV1 FUSION GENE, INCLUDED; TMPS2_HUMAN; Transmembrane protease serine 2 catalytic chain; Transmembrane protease, serine 2; Transmembrane protease, serine 2, EC 3.4.219

• Abbreviation:

  Recombinant Human TMPRSS2 protein, partial

• Gene Name:

  TMPRSS2

• UniProt:

  O15393

• Expression Region:

  106-492aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

• Tag:

  N-terminal 6xHis-tagged

• Type:

  In Stock Protein & Coronavirus Protein

• Source:

  E.coli

• Field of Research:

  Cancer

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  46.9 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial