Recombinant Leiurus hebraeus Beta-mammal/insect toxin Lqhb1

CAT:
399-GTR04828552
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Leiurus hebraeus Beta-mammal/insect toxin Lqhb1

  • Product Name Alternative:

    Lqh-beta-1

  • Abbreviation:

    Recombinant Leiurus hebraeus Beta-mammal/insect toxin Lqhb1 protein

  • UniProt:

    P0C5H3

  • Expression Region:

    20-85aa

  • Organism:

    Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

  • Target Sequence:

    DNGYLLNKATGCKVWCVINNASCNSECKLRRGNYGYCYFWKLACYCEGAPKSELWAYATNKCNGKL

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    Developed Protein

  • Source:

    Baculovirus

  • Field of Research:

    Others

  • Relevance:

    Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. Competes, with apparent high affinity, with anti-insect and anti-mammalian beta-toxins for binding to cockroach and rat brain synaptosomes, respectively. Also competes with an anti-mammalian alpha-toxin on binding to rat brain sodium channels. Has a weak effect on cardiac sodium channels and a marked effect on rat brain and skeletal muscle sodium channels.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    11.5 kDa

  • References & Citations:

    "An 'Old World' scorpion beta-toxin that recognizes both insect and mammalian sodium channels." Gordon D., Ilan N., Zilberberg N., Gilles N., Urbach D., Cohen L., Karbat I., Froy O., Gaathon A., Kallen R.G., Benveniste M., Gurevitz M. Eur. J. Biochem. 270:2663-2670 (2003)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein