Recombinant Newcastle disease virus RNA-directed RNA polymerase L (L), partial

CAT:
399-GTR04837574
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Newcastle disease virus RNA-directed RNA polymerase L (L), partial

  • Product Name Alternative:

    Protein L; Large structural protein; Replicase; Transcriptase; EC 2.7.7.48; EC 3.6.1.-; EC 2.7.7.88; PRNTase; EC 2.1.1.375; mRNA guanine-N7; G-N7-MTase', "mRNA nucleoside-2'-O-", "N1-2'-O-MTase"]

  • Abbreviation:

    Recombinant Newcastle disease virus RNA-directed RNA polymerase L protein, partial

  • Gene Name:

    L

  • UniProt:

    Q9DLD3

  • Expression Region:

    1741-1960aa

  • Organism:

    Newcastle disease virus (strain Chicken/United States/B1/48) (NDV)

  • Target Sequence:

    RYLFRGIGTASSSWYKASHLLSVPEVRCARHGNSLYLAEGSGAIMSLLELHVPHETIYYNTLFSNEMNPPQRHFGPTPTQFLNSVVYRNLQAEVTCKDGFVQEFRPLWRENTEESDLTSDKAVGYITSAVPYRSVSLLHCDIEIPPGSNQSLLDQLAINLSLIAMHSVREGGVVIIKVLYAMGYYFHLLMNLFAPCSTKGYILSNGYACRGDMECYLVFV

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N) . The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concommitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.; RNA-directed RNA polymerase that catalyzes the replication of viral genomic RNA. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N) . The replicase mode is dependent on intracellular N protein concentration. In this mode, the polymerase replicates the whole viral genome without recognizing transcriptional signals, and the replicated genome is not caped or polyadenylated.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Bioactivity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    30.7 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial