Recombinant Human STEAP1 protein (STEAP1) -VLPs

CAT:
399-GTR04828969
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human STEAP1 protein (STEAP1) -VLPs

  • Product Name Alternative:

    Six-transmembrane epithelial antigen of prostate 1

  • Abbreviation:

    Recombinant Human STEAP1 protein-VLPs

  • Gene Name:

    STEAP1

  • UniProt:

    Q9UHE8

  • Expression Region:

    1-339aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    MP-VLP Transmembrane Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Epigenetics and Nuclear Signaling

  • Relevance:

    Metalloreductase that has the ability to reduce both Fe (3+) to Fe (2+) and Cu (2+) to Cu (1+) . Uses NAD (+) as acceptor.

  • Endotoxin:

    Not test

  • Purity:

    The purity information is not available for VLPs proteins.

  • Activity:

    Not Test

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

  • Molecular Weight:

    41.2 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length