Recombinant Mouse Interleukin-36 gamma protein (Il36g) (Active)

CAT:
399-GTR04836128
Size:
500 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Interleukin-36 gamma protein (Il36g) (Active)

  • Product Name Alternative:

    Interleukin-1 family member 9

  • Abbreviation:

    Recombinant Mouse Il36g protein (Active)

  • Gene Name:

    Il36g

  • UniProt:

    Q8R460

  • Expression Region:

    13-164aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

  • Tag:

    Tag-Free

  • Type:

    Active Protein & In Stock Protein

  • Source:

    E.Coli

  • Field of Research:

    Immunology

  • Relevance:

    Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP (By similarity) . Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in proinflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of proinflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4 (+) T cells and splenocytes. {ECO:0000250|UniProtKB:Q9NZH8, ECO:0000269|PubMed:21860022, ECO:0000269|PubMed:21965679}.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    >97% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion in murine NIH/3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 x 105 IU/mg.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, pH 8.5, 150mM NaCl with Tween-20

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Functions as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP (By similarity) . Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. May play a role in proinflammatory responses during particular neutrophilic airway inflammation. May be involved in the innate immune response to fungal pathogens. Induces the production of proinflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by cultured CD4 (+) T-cells and splenocytes.

  • Molecular Weight:

    17.3 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein