Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1

CAT:
399-GTR04828323
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Pseudonaja textilis textilis Kunitz-type serine protease inhibitor textilinin-1

  • Product Name Alternative:

    (Txln-1)

  • Abbreviation:

    Recombinant Pseudonaja textilis textilis Txln-1 protein

  • UniProt:

    Q90WA1

  • Expression Region:

    25-83aa

  • Organism:

    Pseudonaja textilis textilis (Eastern brown snake)

  • Target Sequence:

    KDRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCAA

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Strongly inhibits plasmin (Ki=0.44 nM) and trypsin (Ki=0.42 nM) . Has little effect on plasma (Ki=1870 nM) and tissue (Ki=12900 nM) kallikreins. In vivo, reduces bleeding in a small animal model.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    14.1 kDa

  • References & Citations:

    "Textilinin-1, an alternative anti-bleeding agent to aprotinin: importance of plasmin inhibition in controlling blood loss." Flight S.M., Johnson L.A., Du Q.S., Warner R.L., Trabi M., Gaffney P.J., Lavin M.F., de Jersey J., Masci P.P. Br. J. Haematol. 145:207-211 (2009)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein