Recombinant Human Ribonuclease T2 (RNASET2)

CAT:
399-GTR04826778
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Ribonuclease T2 (RNASET2)

  • Product Name Alternative:

    Ribonuclease 6

  • Abbreviation:

    Recombinant Human RNASET2 protein

  • Gene Name:

    RNASET2

  • UniProt:

    O00584

  • Expression Region:

    25-256aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

  • Tag:

    C-terminal hFc1-tagged

  • Type:

    In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Ribonuclease that plays an essential role in innate immune response by recognizing and degrading RNAs from microbial pathogens that are subsequently sensed by TLR8 (PubMed:31778653) . Cleaves preferentially single-stranded RNA molecules between purine and uridine residues, which critically contributes to the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides (PubMed:31778653) . In turn, RNase T2 degradation products promote the RNA-dependent activation of TLR8 (PubMed:31778653) . Plays also a key role in degradation of mitochondrial RNA and processing of non-coding RNA imported from the cytosol into mitochondria (PubMed:28730546, PubMed:30184494) . Participates as well in degradation of mitochondrion-associated cytosolic rRNAs.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    56.1 kDa

  • References & Citations:

    "Structure and activity of the only human RNase T2." Thorn A., Steinfeld R., Ziegenbein M., Grapp M., Hsiao H.H., Urlaub H., Sheldrick G.M., Gartner J., Kratzner R. Nucleic Acids Res. 40:8733-8742 (2012)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein