Recombinant Human Tissue factor (F3), partial

CAT:
399-GTR04828821
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Tissue factor (F3), partial

  • Product Name Alternative:

    Tissue Factor; TF; Coagulation Factor III; Thromboplastin; CD142; F3

  • Abbreviation:

    Recombinant Human F3 protein, partial

  • Gene Name:

    F3

  • UniProt:

    P13726

  • Expression Region:

    33-251aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

  • Tag:

    Tag free

  • Type:

    In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Others

  • Endotoxin:

    < 1 EU/mg as determined by LAL test.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Not test

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from 0.22 μm filtered solution in PBS, 5%mannital, 0.01% Tween80 pH7.4.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    24.8 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial