Recombinant Mouse Fibroblast growth factor 2 (Fgf2) (Active)

CAT:
399-GTR04827404
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Fibroblast growth factor 2 (Fgf2) (Active)

  • Product Name Alternative:

    Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2

  • Abbreviation:

    Recombinant Mouse Fgf2 protein (Active)

  • Gene Name:

    Fgf2

  • UniProt:

    P15655

  • Expression Region:

    1-154aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

  • Tag:

    Tag-Free

  • Type:

    Active Protein & In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Signal Transduction

  • Relevance:

    FGF basic is one of 22 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine, and sheep FGF basic. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis is reminiscent of a variety of pathological conditions.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-1.8 ng/ml.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, 0.02% Tween 80, 4.0% Sucrose, 4.0% Manntiol, pH 7.0

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.

  • Molecular Weight:

    17.15 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length