Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial

CAT:
399-GTR04830857
Size:
50 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial

  • Product Name Alternative:

    Pp1ab; ORF1ab polyprotein

  • Abbreviation:

    Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab protein, partial

  • Gene Name:

    Rep

  • UniProt:

    P12723

  • Expression Region:

    1-219aa

  • Organism:

    Avian infectious bronchitis virus (strain KB8523) (IBV)

  • Target Sequence:

    GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ

  • Tag:

    C-terminal 6xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    Baculovirus

  • Field of Research:

    Others

  • Relevance:

    The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. NendoU is a Mn2+-dependent, uridylate-specific enzyme, which leaves 2'-3'-cyclic phosphates 5' to the cleaved bond.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    30.1 kDa

  • References & Citations:

    "Cloning and sequencing of genes encoding structural proteins of avian infectious bronchitis virus." Sutou S., Sato S., Okabe T., Nakai M., Sasaki N. Virology 165:589-595 (1988)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial