Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G), partial, Biotinylated

CAT:
399-GTR04827380
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G), partial, Biotinylated

  • Product Name Alternative:

    (Attachment glycoprotein G) (Membrane-bound glycoprotein) (mG) (Mature sG)

  • Abbreviation:

    Recombinant Human respiratory syncytial virus A G protein, partial, Biotinylated

  • Gene Name:

    G

  • UniProt:

    P03423

  • Expression Region:

    67-298aa

  • Organism:

    Human respiratory syncytial virus A (strain A2)

  • Target Sequence:

    HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ

  • Tag:

    N-terminal 6xHis-SUMO3-Avi-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    [Isoform Membrane-bound glycoprotein G]: Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (Probable) . ; [Isoform Secreted glycoprotein G]: Helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    39.2 kDa

  • References & Citations:

    The RSV F and G glycoproteins interact to form a complex on the surface of infected cells.Low K.W., Tan T., Ng K., Tan B.H., Sugrue R.J.Biochem. Biophys. Res. Commun. 366:308-313 (2008)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial