Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

CAT:
399-GTR04829920
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial (Active)

  • Product Name Alternative:

    Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor; Gipr

  • Abbreviation:

    Recombinant Rat Gipr protein, partial (Active)

  • Gene Name:

    Gipr

  • UniProt:

    P43219

  • Expression Region:

    19-135aa

  • Organism:

    Rattus norvegicus (Rat)

  • Target Sequence:

    RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Obesity

  • Relevance:

    May play an important role in blood sugar regulation.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2 μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO), the EC50 is 6.946-8.740 ng/ml.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    14.9 kDa

  • References & Citations:

    "The cysteine of the cytoplasmic tail of glucose-dependent insulinotropic peptide receptor mediates its chronic desensitization and down- regulation."Tseng C.C., Zhang X.Y.Mol Cell Endocrinol 139:179-186 (1998)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial