Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

CAT:
399-GTR04830309
Size:
200 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

  • Product Name Alternative:

    5-HT-1D;5-HT1D; Serotonin 1D alpha receptor;5-HT-1D-alpha; Serotonin receptor 1D

  • Abbreviation:

    Recombinant Human HTR1D protein, partial

  • Gene Name:

    HTR1D

  • UniProt:

    P28221

  • Expression Region:

    1-38aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

  • Tag:

    C-terminal hFc1-tagged

  • Type:

    In Stock Protein

  • Source:

    Yeast

  • Field of Research:

    Others

  • Relevance:

    G-protein coupled receptor for 5-hydroxytryptamine (serotonin) . Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    32.3 kDa

  • References & Citations:

    "Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed." Xie Z., Lee S.P., O'Dowd B.F., George S.R. FEBS Lett. 456:63-67 (1999)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial