Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial

• Abbreviation:

  Recombinant Torpedo californica CHRNA1 protein, partial

• Gene Name:

  CHRNA1

• UniProt:

  P02710

• Expression Region:

  25-234aa

• Organism:

  Torpedo californica (Pacific electric ray)

• Target Sequence:

  SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

• Tag:

  Tag-Free

• Source:

  E.coli

• Field of Research:

  Neuroscience

• Relevance:

  After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Lyophilized

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  24.9 kDa

• References & Citations:

  "Proteolytic fragments of the nicotinic acetylcholine receptor identified by mass spectrometry: implications for receptor topography." Moore C.R., Yates J.R. III, Griffin P.R., Shabanowitz J., Martino P.A., Hunt D.F., Cafiso D.S. Biochemistry 28:9184-9191 (1989)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial