Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH) (V48C, L55C, R81P, N91S, S99N, T179P) , partial

CAT:
399-GTR04838145
Size:
200 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH) (V48C, L55C, R81P, N91S, S99N, T179P) , partial

  • CAS Number:

    9000-83-3

  • Gene Name:

    fimH

  • UniProt:

    P08191

  • Expression Region:

    22-180aa (V48C, L55C, R81P, N91S, S99N, T179P)

  • Organism:

    Escherichia coli (strain K12)

  • Target Sequence:

    FACKTANGTAIPIGGGSANVYVNLAPCVNVGQNCVVDLSTQIFCHNDYPETITDYVTLQPGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPPG

  • Tag:

    N-terminal 6xHis-tagged

  • Source:

    Yeast

  • Field of Research:

    Others

  • Assay Type:

    In Stock Protein

  • Relevance:

    Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Length:

    Partial

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    18.4 kDa

  • References & Citations:

    Three fim genes required for the regulation of length and mediation of adhesion of Escherichia coli type 1 fimbriae.Klemm P., Christiansen G.Mol. Gen. Genet. 208:439-445 (1987)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.