Recombinant Human Zinc finger protein GLI1 (GLI1), partial

CAT:
399-GTR04837315
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Zinc finger protein GLI1 (GLI1), partial

  • Product Name Alternative:

    Glioma-associated oncogeneOncogene GLI

  • Abbreviation:

    Recombinant Human GLI1 protein, partial

  • Gene Name:

    GLI1

  • UniProt:

    P08151

  • Expression Region:

    921-1106aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Developmental Biology

  • Relevance:

    Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous syst and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Acts as a transcriptional activator

  • Molecular Weight:

    23.3 kDa

  • References & Citations:

    Polymorphic variants of the human oncogene GLI1 function similarly.Yoon J.W., Kent P., Clark A., Patterson J., Villavicencio E., Iannaccone P., Walterhouse D.A novel splice variant of GLI1 that promotes glioblastoma cell migration and invasion.Lo H.W., Zhu H., Cao X., Aldrich A., Ali-Osman F.Cancer Res. 69:6790-6798 (2009)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial