Recombinant Human Myosin regulatory light chain 12A (MYL12A) (Active)

• Product Name Alternative:

  MLCB; MRLC3; RLC

• Abbreviation:

  Recombinant Human MYL12A protein (Active)

• Gene Name:

  MYL12A

• UniProt:

  P19105

• Expression Region:

  1-171aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

• Tag:

  C-terminal 6xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  E.coli

• Field of Research:

  Cancer

• Relevance:

  Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human MYL12A at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU) . The EC50 is 5.325-6.456 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  26.7 kDa

• References & Citations:

  "Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells." Iwasaki T., Murata-Hori M., Ishitobi S., Hosoya H. Cell Struct. Funct. 26:677-683 (2001) "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team. Genome Res. 14:2121-2127 (2004) "Isoforms of myosin and actin in human, monkey and rat myometrium. Comparison of pregnant and non-pregnant uterus proteins." Cavaille F., Janmot C., Ropert S., d'Albis A. Eur J Biochem 160:507-513 (1986)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length