Recombinant Mouse Interleukin-4 protein (Il4) (Active)

CAT:
399-GTR04826035
Size:
500 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Interleukin-4 protein (Il4) (Active)

  • Product Name Alternative:

    IL-4, B-cell growth factor 1, B-cell stimulatory factor 1, BSF-1, IGG1 induction factor

  • Abbreviation:

    Recombinant Mouse Il4 protein (Active)

  • Gene Name:

    Il4

  • UniProt:

    P07750

  • Expression Region:

    21-140aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    M+HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

  • Tag:

    Tag-Free

  • Type:

    Active Protein & In Stock Protein

  • Source:

    E.Coli

  • Field of Research:

    Immunology

  • Relevance:

    Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    >97% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant prolifiration of Murine HT-2 cells is less then 2 ng/ml, corresponding to a Specific Activity of > 5 x 105 IU/mg.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 µm filtered , PBS, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Participates in at least several B-cell activation processes as well as of other cell types

  • Molecular Weight:

    13.5 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein