Recombinant Human cytomegalovirus Cytoplasmic envelopment protein 3 (UL99)

CAT:
399-GTR04825622
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human cytomegalovirus Cytoplasmic envelopment protein 3 (UL99)

  • Product Name Alternative:

    28KDA structural phosphoprotein pp28

  • Abbreviation:

    Recombinant Human cytomegalovirus UL99 protein

  • Gene Name:

    UL99

  • UniProt:

    P13200

  • Expression Region:

    2-190aa

  • Organism:

    Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

  • Target Sequence:

    GAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSDEGEDDDDGEDDDNEERQQKLRLCGSGCGGNDSSSGSHREATHDGSKKNAVRSTFREDKAPKPSKQSKKKKKPSKHHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPRPDTPRTPRQKKISQRPPTPGTKKPAASLPF

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Plays an important role in the cytoplasmic envelopment of tegument proteins and capsids during the assembly and egress processes. Participates also in viral entry at the fusion step probably by regulating the core fusion machinery.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    24.8 kDa

  • References & Citations:

    "Interaction between the human cytomegalovirus tegument proteins UL94 and UL99 is essential for virus replication." Phillips S.L., Cygnar D., Thomas A., Bresnahan W.A.J. Virol. 86:9995-10005 (2012)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein