Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)

CAT:
399-GTR13816800
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)

  • Product Name Alternative:

    B-cell maturation protein (CD_antigen: CD269) (BCM) (BCMA)

  • Abbreviation:

    Recombinant Human TNFRSF17 protein, partial (Active)

  • Gene Name:

    TNFRSF17

  • UniProt:

    Q02223

  • Expression Region:

    1-54aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    ①Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA1HU) . The EC50 is 5.652-7.215 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA3HU) . The EC50 is 2.296-2.754ng/mL. ③Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA4HU) . The EC50 is 14.97-19.19 ng/mL. ④Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13 protein (CSB-MP023989HU) . The EC50 is 4.217-5.674 ng/mL. ⑤Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF17 protein at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1) . The EC50 is 4.346-5.534 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    7.6 kDa

  • References & Citations:

    "The BCMA gene, preferentially expressed during B lymphoid maturation, is bidirectionally transcribed." Laabi Y., Gras M.P., Brouet J.C., Berger R., Larsen C.J., Tsapis A. Nucleic Acids Res. 22:1147-1154 (1994)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial