Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) (Active)

CAT:
399-GTR13816582
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Ly6/PLAUR domain-containing protein 3 (LYPD3) (Active)

  • Product Name Alternative:

    Ly6/PLAUR domain-containing protein 3; GPI-anchored metastasis-associated protein C4.4A homolog; Matrigel-induced gene C4 protein (MIG-C4) ; LYPD3; C4.4A; UNQ491/PRO1007

  • Abbreviation:

    Recombinant Human LYPD3 protein (Active)

  • Gene Name:

    LYPD3

  • UniProt:

    O95274

  • Expression Region:

    31-326aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA.Immobilized Human LYPD3 at 2 μg/mL can bind Anti-LYPD3 recombinant antibody (CSB-RA013263MA2HU) . The EC50 is 2.375-2.905 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    32.4 kDa

  • References & Citations:

    The DNA sequence and biology of human chromosome 19. Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Lucas S.M. Nature 428:529-535 (2004)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein