Recombinant Chlorocebus sabaeus Claudin (CLDN6) -VLPs (Active)

CAT:
399-GTR13816566
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Chlorocebus sabaeus Claudin (CLDN6) -VLPs (Active)

  • Product Name Alternative:

    /

  • Abbreviation:

    Recombinant Chlorocebus sabaeus CLDN6 protein-VLPs (Active)

  • Gene Name:

    CLDN6

  • UniProt:

    A0A0D9SBX5

  • Expression Region:

    22-220aa

  • Organism:

    Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)

  • Target Sequence:

    LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV

  • Tag:

    C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

  • Type:

    MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    The purity information is not available for VLPs proteins.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU) . The EC50 is 4.186-6.635 ng/mL.The VLPs (CSB-MP3838) is negative control.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

  • Molecular Weight:

    22.6 kDa

  • References & Citations:

    Warren W., Wilson R.K. Submitted to EMBL/GenBank/DDBJ databases (MAR-2014)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein