Recombinant Human immunodeficiency virus 1 Protein Rev (rev) (D62T, T68A)

CAT:
399-GTR13816316
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human immunodeficiency virus 1 Protein Rev (rev) (D62T, T68A)

  • Abbreviation:

    Recombinant Human immunodeficiency virus 1 rev protein (D62T, T68A)

  • Gene Name:

    Rev

  • UniProt:

    Q9DKF2

  • Expression Region:

    1-107aa (D62T, T68A)

  • Organism:

    Human immunodeficiency virus 1

  • Target Sequence:

    MAGRSGDSDEALLRAVRIIKILYQSNPYPEPRGTRQARKNRRRRWRARQNQIHSISERILSTCLGRPAEPVPLQLPPLERLHITDSERGGTSGTQQPQGTTEGVGSP

  • Tag:

    N-terminal 10xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    18.0 kDa

  • References & Citations:

    "A recent outbreak of human immunodeficiency virus type 1 infection in southern China was initiated by two highly homogeneous, geographically separated strains, circulating recombinant form AE and a novel BC recombinant." Piyasirisilp S., McCutchan F.E., Carr J.K., Sanders-Buell E., Liu W., Chen J., Wagner R., Wolf H., Shao Y., Lai S., Beyrer C., Yu X.F. J. Virol. 74:11286-11295 (2000)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length