Recombinant Human Oncostatin-M protein (OSM), partial (Active)

CAT:
399-GTR04826539
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Oncostatin-M protein (OSM), partial (Active)

  • Product Name Alternative:

    OSM

  • Abbreviation:

    Recombinant Human OSM protein, partial (Active)

  • Gene Name:

    OSM

  • UniProt:

    P13725

  • Expression Region:

    26-234aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR

  • Tag:

    Tag-Free

  • Type:

    Active Protein & In Stock Protein

  • Source:

    E.Coli

  • Field of Research:

    Immunology

  • Relevance:

    Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST) . Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity) . {ECO:0000250}.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    >97% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 105 IU/mg.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST) . Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity) .

  • Molecular Weight:

    23.7 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial