Recombinant Human Protein delta homolog 1 (DLK1), partial (Active)

CAT:
399-GTR13447718
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Protein delta homolog 1 (DLK1), partial (Active)

  • Product Name Alternative:

    Protein delta homolog 1; DLK-1; pG2; DLK1; DLK

  • Abbreviation:

    Recombinant Human DLK1 protein, partial (Active)

  • Gene Name:

    DLK1

  • UniProt:

    P80370

  • Expression Region:

    24-303aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Signal Transduction

  • Relevance:

    May have a role in neuroendocrine differentiation.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    ①Measured by its binding ability in a functional ELISA. Immobilized Human DLK1 at 2 μg/mL can bind Anti-DLK1 recombinant antibody (CSB-RA006945MA1HU) . The EC50 is 1.598-1.804 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human DLK1 at 2 μg/mL can bind Anti-DLK1 recombinant antibody (CSB-RA006945MA2HU) . The EC50 is 1.935-2.143 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    31.2 kDa

  • References & Citations:

    Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD. Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. Mol. Cell. Proteomics 11:1-17 (2012)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial