Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active)

• Product Name Alternative:

  B-cell maturation protein (CD_antigen: CD269) (BCM) (BCMA)

• Abbreviation:

  Recombinant Human TNFRSF17 protein, partial (Active)

• Gene Name:

  TNFRSF17

• UniProt:

  Q02223

• Expression Region:

  1-54aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

• Tag:

  C-terminal mFc-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  ①Measured by its binding ability in a functional ELISA. Immobilized Anti-TNFRSF17 recombinant antibody (CSB-RA023974MA3HU) at 2 μg/mL can bind Human TNFRSF17 protein. The EC50 is 1.745-1.901 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13B protein (CSB-MP897523HU1-B) at 2 μg/mL can bind Human TNFRSF17 protein. The EC50 is 2.232-2.579 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  35.2 kDa

• References & Citations:

  "The BCMA gene, preferentially expressed during B lymphoid maturation, is bidirectionally transcribed." Laabi Y., Gras M.P., Brouet J.C., Berger R., Larsen C.J., Tsapis A. Nucleic Acids Res. 22:1147-1154 (1994)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial