Recombinant Human Interleukin-1 receptor accessory protein-like 1 (IL1RAPL1), partial (Active)

CAT:
399-GTR13447816
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Interleukin-1 receptor accessory protein-like 1 (IL1RAPL1), partial (Active)

  • Product Name Alternative:

    Interleukin-1 receptor accessory protein-like 1; EC:3.2.2.6; IL-1-RAPL-1; IL-1RAPL-1; IL1RAPL-1; Oligophrenin-4; Three immunoglobulin domain-containing IL-1 receptor-related 2 (TIGIRR-2) ; X-linked interleukin-1 receptor accessory protein-like 1; IL1RAPL1; OPHN4

  • Abbreviation:

    Recombinant Human IL1RAPL1 protein, partial (Active)

  • Gene Name:

    IL1RAPL1

  • UniProt:

    Q9NZN1

  • Expression Region:

    19-357aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

  • Tag:

    C-terminal hFc1-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Neuroscience

  • Relevance:

    May regulate secretion and presynaptic differentiation through inhibition of the activity of N-type voltage-gated calcium channel. May activate the MAP kinase JNK. Plays a role in neurite outgrowth. During dendritic spine formation can bidirectionally induce pre- and post-synaptic differentiation of neurons by trans-synaptically binding to PTPRD.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human PTPRD protein (CSB-MP019051HU (A4) ) at 2 μg/mL can bind Human IL1RAPL1 protein. The EC50 is 2.645-3.098 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    66.4 kDa

  • References & Citations:

    A truncating mutation in the IL1RAPL1 gene is responsible for X-linked mental retardation in the MRX21 family. Tabolacci E., Pomponi M.G., Pietrobono R., Terracciano A., Chiurazzi P., Neri G. Am. J. Med. Genet. A 140:482-487 (2006)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial