Recombinant Human Lymphocyte activation gene 3 protein (LAG3), partial (Active)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Human Lymphocyte activation gene 3 protein (LAG3), partial (Active)
Product Name Alternative:
Lymphocyte activation gene 3 protein; LAG-3; CD223; LAG3; FDC
Abbreviation:
Recombinant Human LAG3 protein, partial (Active)
Gene Name:
LAG3
UniProt:
P18627-1
Expression Region:
23-434aa
Organism:
Homo sapiens (Human)
Target Sequence:
LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPG
Tag:
C-terminal 10xHis-tagged
Type:
Active Protein & In Stock Protein
Source:
Mammalian cell
Field of Research:
Immunology
Relevance:
Lymphocyte activation gene 3 protein: Inhibitory receptor on antigen activated T-cells . Delivers inhibitory signals upon binding to ligands, such as FGL1. FGL1 constitutes a major ligand of LAG3 and is responsible for LAG3 T-cell inhibitory function . Following TCR engagement, LAG3 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation . May inhibit antigen-specific T-cell activation in synergy with PDCD1/PD-1, possibly by acting as a coreceptor for PDCD1/PD-1 . Negatively regulates the proliferation, activation, effector function and homeostasis of both CD8+Â and CD4+Â T-cells . Also mediates immune tolerance: constitutively expressed on a subset of regulatory T-cells (Tregs) and contributes to their suppressive function. Also acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation. Binds MHC class II (MHC-II) ; the precise role of MHC-II-binding is however unclear . Secreted lymphocyte activation gene 3 protein May function as a ligand for MHC class II (MHC-II) on antigen-presenting cells (APC), promoting APC activation/maturation and driving Th1 immune response.
Endotoxin:
Less than 1.0 EU/μg as determined by LAL method.
Purity:
Greater than 90% as determined by SDS-PAGE.
Activity:
Yes
Bioactivity:
Measured by its binding ability in a functional ELISA. Immobilized Human LAG3 at 2 μg/mL can bind Anti-LAG3 recombinant antibody (CSB-RA012719MA1HU) . The EC50 is 2.306-2.731 ng/mL.
Form:
Lyophilized powder
Buffer:
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight:
46.1 kDa
References & Citations:
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Partial of Isoform 1