Recombinant Rat Glucagon receptor (Gcgr), partial (Active)

CAT:
399-GTR13447416
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Rat Glucagon receptor (Gcgr), partial (Active)

  • Product Name Alternative:

    Glucagon receptor; GL-R; Gcgr

  • Abbreviation:

    Recombinant Rat Gcgr protein, partial (Active)

  • Gene Name:

    Gcgr

  • UniProt:

    P30082

  • Expression Region:

    27-137aa

  • Organism:

    Rattus norvegicus (Rat)

  • Target Sequence:

    AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQSWRDASQCQMDDDEIEVQKGVAK

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Rat Gcgr at 2 μg/mL can bind Anti-Gcgr recombinant antibody (CSB-RA009316MA1HU) . The EC50 is 29.63-35.34 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    14.4 kDa

  • References & Citations:

    Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues. Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V. Nat. Commun. 3:876-876 (2012)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial