Recombinant Sheep Bone morphogenetic protein 15 (BMP15)

CAT:
399-GTR04830838
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Sheep Bone morphogenetic protein 15 (BMP15)

  • Product Name Alternative:

    (BMP-15) (Growth/differentiation factor 9B) (GDF-9B)

  • Abbreviation:

    Recombinant Sheep BMP15 protein

  • Gene Name:

    BMP15

  • UniProt:

    Q9MZE2

  • Expression Region:

    269-393aa

  • Organism:

    Ovis aries (Sheep)

  • Target Sequence:

    QAGSIASEVPGPSREHDGPESNQCSLHPFQVSFQQLGWDHWIIAPHLYTPNYCKGVCPRVLHYGLNSPNHAIIQNLVSELVDQNVPQPSCVPYKYVPISILLIEANGSILYKEYEGMIAQSCTCR

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Cardiovascular

  • Relevance:

    May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    21.3 kDa

  • References & Citations:

    "A novel mutation in the bone morphogenetic protein 15 gene causing defective protein secretion is associated with both increased ovulation rate and sterility in Lacaune sheep." Bodin L., Di Pasquale E., Fabre S., Bontoux M., Monget P., Persani L., Mulsant P. Endocrinology 148:393-400 (2007)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein