Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein (GP2b)

CAT:
399-GTR04824726
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein (GP2b)

  • Product Name Alternative:

    (Protein E) (Glycoprotein 2b) (Protein GP2b) (Gs)

  • Abbreviation:

    Recombinant Porcine reproductive and respiratory syndrome virus GP2b protein

  • Gene Name:

    GP2b

  • UniProt:

    P0C6Y6

  • Expression Region:

    2-70aa

  • Organism:

    Porcine reproductive and respiratory syndrome virus (strain Lelystad) (PRRSV)

  • Target Sequence:

    GSLWSKISQLFVDAFTEFLVSVVDIAIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAIHSPELSKVL-

  • Tag:

    N-terminal 10xHis-tagged

  • Type:

    CF Transmembrane Protein & Developed Protein

  • Source:

    In vitro E.coli expression system

  • Field of Research:

    Others

  • Relevance:

    Minor envelope protein. May function as a viroporin in the virion envelope that facilitates uncoating of the virus in order to release the genomic RNA into the cytoplasm for subsequent replication.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    13.7 kDa

  • References & Citations:

    "The small envelope protein of porcine reproductive and respiratory syndrome virus possesses ion channel protein-like properties." Lee C., Yoo D. Virology 355:30-43 (2006)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length