Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)

CAT:
399-GTR04828377
Size:
500 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)

  • Product Name Alternative:

    CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

  • Abbreviation:

    Recombinant Human TNFRSF9 protein, partial (Active)

  • Gene Name:

    TNFRSF9

  • UniProt:

    Q07011

  • Expression Region:

    24-186aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

  • Tag:

    C-terminal Fc-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL) .

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BBL-His at 10μg/ml can bind Human 4-1BB-Fc, the ED50 of Human 4-1BB-Fc is 16.8 ng/ml.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

  • Molecular Weight:

    44.2 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Extracellular Domain