Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1)
Product Name Alternative:
CysLTR1; Cysteinyl leukotriene D4 receptor; LTD4 receptor; G-protein coupled receptor HG55; HMTMF81
Abbreviation:
Recombinant Human CYSLTR1 protein
Gene Name:
CYSLTR1
UniProt:
Q9Y271
Expression Region:
1-337aa
Organism:
Homo sapiens (Human)
Target Sequence:
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Tag:
N-terminal 10xHis-tagged
Type:
CF Transmembrane Protein & In Stock Protein
Source:
In vitro E.coli expression system
Field of Research:
Others
Relevance:
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
Endotoxin:
Not test
Purity:
Greater than 85% as determined by SDS-PAGE.
Activity:
Not Test
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight:
44.6 kDa
References & Citations:
"Identification, molecular cloning, expression, and characterization of a cysteinyl leukotriene receptor." Sarau H.M., Ames R.S., Chambers J., Ellis C., Elshourbagy N., Foley J.J., Schmidt D.B., Muccitelli R.M., Jenkins O., Murdock P.R., Herrity N.C., Halsey W., Sathe G., Muir A.I., Nuthulaganti P., Dytko G.M., Buckley P.T., Wilson S., Bergsma D.J., Hay D.W.P. Mol. Pharmacol. 56:657-663 (1999)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Full Length