Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active)

CAT:
399-GTR04835122
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human B- and T-lymphocyte attenuator (BTLA), partial (Active)

  • Product Name Alternative:

    (B- and T-lymphocyte-associated protein) (CD272)

  • Abbreviation:

    Recombinant Human BTLA protein, partial (Active)

  • Gene Name:

    BTLA

  • UniProt:

    Q7Z6A9

  • Expression Region:

    31-150aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS

  • Tag:

    C-terminal hFc1-Myc-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:12796776, PubMed:14652006, PubMed:15568026, PubMed:18193050) . May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14 (PubMed:19915044) . In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells (PubMed:19915044) .

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    ①Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 μg/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A), the EC50 is 137.8-233.4 ng/ml.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    43.9 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial