Recombinant Human ALK and LTK ligand 2 (ALKAL2)

• Product Name Alternative:

  Augmentor alpha (AUG-alpha) (Protein FAM150B) (FAM150B)

• Abbreviation:

  Recombinant Human ALKAL2 protein

• Gene Name:

  ALKAL2

• UniProt:

  Q6UX46

• Expression Region:

  25-152aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  Baculovirus

• Field of Research:

  Others

• Relevance:

  Ligand for receptor tyrosine kinases LTK and ALK. Stimulation of ALK signaling may be involved in regulation of cell proliferation and transformation

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  18.4 kDa

• References & Citations:

  "ALKALs are in vivo ligands for ALK family receptor tyrosine kinases in the neural crest and derived cells." Fadeev A., Mendoza-Garcia P., Irion U., Guan J., Pfeifer K., Wiessner S., Serluca F., Singh A.P., Nusslein-Volhard C., Palmer R.H. Proc. Natl. Acad. Sci. U.S.A. 115:E630-E638 (2018)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein