Recombinant Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C), partial (Active)

• Product Name Alternative:

  Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID

• Abbreviation:

  Recombinant Human TNFRSF10C protein, partial (Active)

• Gene Name:

  TNFRSF10C

• UniProt:

  O14798

• Expression Region:

  26-221aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

• Tag:

  C-terminal 6xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membrane protein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks the intracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn’t transduce an apoptosis signal. The expression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-induced apoptosis.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 0.56 ng/ml.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.

• Molecular Weight:

  21.78 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial