Recombinant Human herpesvirus 6B Glycoprotein Q1 (U100) (X130S, X223S), partial

CAT:
399-GTR04826245
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human herpesvirus 6B Glycoprotein Q1 (U100) (X130S, X223S), partial

  • Product Name Alternative:

    Glycoprotein 105 Glycoprotein Q-80k HCLF1 protein

  • Abbreviation:

    Recombinant Human herpesvirus 6B U100 protein (X130S, X223S), partial

  • Gene Name:

    U100

  • UniProt:

    Q9QJ11

  • Expression Region:

    25-354aa (X130S, X223S)

  • Organism:

    Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

  • Target Sequence:

    TVHRDAGTVESTPPPDDEDNYTAKYYDDSIYFNIYDGTNPTPRRRTLPEIISKFSTSEMSRLGGLKAFVPVDYTPTTTLEDIEDLLNYAICDDNSCGCLIETEARSMFGDIIICVPLSAESRGVRNLKSRIMPMGLSQILSSGLGLHFSLLYGAFGSNYNSLAYMERLKPLTAMTAIAFCPMTSKLELRQNYRLEKARSNLIVNIELLKIQNHGGQTIKTLTSFAIVRKDSDGQDWETCTRFASVSIEDILRSKPAANGTCCPPRDVHHDRPTLQSSNSWTRTEYFEPWQDVVDAYVPINDNHCPNDSYVVFQTLQGHEWCSRLNKNDTK

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Plays a role in virus entry by participating in host receptor binding at the cell surface.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    44.6 kDa

  • References & Citations:

    "Analysis of a neutralizing antibody for human herpesvirus 6B reveals a role for glycoprotein Q1 in viral entry." Kawabata A., Oyaizu H., Maeki T., Tang H., Yamanishi K., Mori Y. J. Virol. 85:12962-12971 (2011)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial