Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), partial (Active)

CAT:
399-GTR04830614
Size:
500 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), partial (Active)

  • Product Name Alternative:

    CD158K; NKAT4

  • Abbreviation:

    Recombinant Human KIR3DL2 protein, partial (Active)

  • Gene Name:

    KIR3DL2

  • UniProt:

    P43630

  • Expression Region:

    22-340aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Receptor on natural killer (NK) cells and T cells for MHC class I molecules. Upon binding of peptide-free HLA-F open conformer, negatively regulates NK and T cell effector functions. Acts as a receptor on astrocytes for HLA-F. Through interaction with HLA-F, may protect motor neurons from astrocyte-induced toxicity.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human KIR3DL2 at 2 μg/mL can bind Anti-KIR3DL2 recombinant antibody (CSB-RA012365MA1HU), the EC50 is 14.18-23.93 ng/mL.

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    36.4 kDa

  • References & Citations:

    "Cloning of immunoglobulin-superfamily members associated with HLA-C and HLA-B recognition by human natural killer cells." Colonna M., Samaridis J. Science 268:405-408 (1995) "Killer cell inhibitory receptors specific for HLA-C and HLA-B identified by direct binding and by functional transfer." Wagtmann N., Rajagopalan S., Winter C.C., Peruzzi M., Long E.O. Immunity 3:801-809 (1995)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial