Recombinant Mouse Reticulon-3 (Rtn3), partial

CAT:
399-GTR04838799
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Reticulon-3 (Rtn3), partial

  • Abbreviation:

    Recombinant Mouse Rtn3 protein, partial

  • Gene Name:

    Rtn3

  • UniProt:

    Q9ES97

  • Expression Region:

    182-440aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    KDQEPKNPNKVPDGEDRSALDFGQSKAEHICTYSLSPSELPVASVEKDSPESPFEVIIDKATFDREFKDLYKENPNDLGGWAAHGDRESPADLLEMNDKLFPLRNKEAGRYPSSVLLGRQFSHTTAALEEVSRCVNDMHNFTNEILTWDLDPQAKQQANKTSCTTESTGLDRSELRSEIPVINLKTNPQQKMPVCSFNGSTPITKSTGDWTEAFTEGKPVRDYLSSTKEAGGNGVPGSSQLHSELPGSMPEKWVSGSGA

  • Tag:

    N-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Cancer

  • Relevance:

    May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. Induces the formation of endoplasmic reticulum tubules. Acts also as an inflammation-resolving regulator by interacting with both TRIM25 and RIG-I/DDX58, subsequently impairing DDX58 'Lys-63'-linked polyubiquitination leading to IRF3 and NF-kappa-B inhibition.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    32.5 kDa

  • References & Citations:

    "Arl6IP1 has the ability to shape the mammalian ER membrane in a reticulon-like fashion." Yamamoto Y., Yoshida A., Miyazaki N., Iwasaki K., Sakisaka T. Biochem. J. 458:69-79 (2014)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial